PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_37256g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 394aa    MW: 44520.1 Da    PI: 6.4331
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_37256g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++v+ +G g+W+ +++  g+ R++k+c++rw +yl
    MA_37256g0010 14 RGLWSPEEDEKLIKYVTAYGHGCWSVVPKQAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding48.91.5e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ +E+ l++d++k  G++ W+ Ia++++ gRt++++k++w++
    MA_37256g0010  67 RGSFSLQEERLIIDLHKIIGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.921965IPR017930Myb domain
SuperFamilySSF466891.24E-2911108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001671.98E-111761No hitNo description
Gene3DG3DSA:1.10.10.607.4E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.01266116IPR017930Myb domain
SMARTSM007173.3E-1566114IPR001005SANT/Myb domain
PfamPF002495.9E-1467110IPR001005SANT/Myb domain
CDDcd001676.78E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLIKYVT AYGHGCWSVV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SLQEERLIID LHKIIGNRWA QIAKHLPGRT DNEVKNFWNS CIKKKLMAQG  120
IDLKAHKLLN QAASSKELQE EKSASLINQG FAASETRDGL KRVADIRELV PGNYMGSFLC  180
AGNADISPYY AIHGGTWMER PTYGDYVRPD QEEILYESIS VNDFRHDISQ RLPVLNDYQI  240
SKSQNFENKL LQPETISDPT TFSSQMKGFD QLKHPFLGPN NPIELGQFGM DAISHYQSTN  300
NQLDTFVIPN AACLSHSSDS GFNPSCDTRR MYLPKLCEIE IAEAECTSDQ GEANGFRFSS  360
AYGSYENYGI EFSDSAITIA MDSECINPVT EWNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32141167108B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.28e-76myb domain protein 26